skip to Main Content
My Account    
Structure of the galanin neuropeptide found in humans. The peptide sequence is GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Structure of the galanin neuropeptide found in humans. The peptide sequence is GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Downloads: full (5536x1580) | large (980x279) | medium (300x85) | thumbnail (150x150)
Back To Top