skip to Main Content

My Account Search by Structure

Search

×

Home
dPEG^® Products
AQ^® Life Science Products
QTalk
- Technology
- Blog
- dPEG^® FAQ
- QNews
- Careers
About Us
Cart0

Cart
Cart

Structure of Galanin in Humans

You are here: Home » PEGylated Galanin Shows Enhanced Analgesic Effects in PNS » Structure of Galanin in Humans

Structure of the galanin neuropeptide found in humans. The peptide sequence is GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Structure of the galanin neuropeptide found in humans. The peptide sequence is GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS

Downloads: full (5536x1580) | large (980x279) | medium (300x85) | thumbnail (150x150)

Follow Us

LinkedIn
Youtube

Privacy Policy
Ordering Information
Terms and Conditions
Copyrights & Trademarks
Careers

Quanta BioDesign develops new cross-linking and labeling chemistries that incorporate the dPEG^® technology; allowing for new approaches in the area of therapeutic and diagnostic development.

Quanta Biodesign, Ltd.

7470 Montgomery Dr,
Plain City, Ohio 43064
United States

614-792-2958

dPEG®, AQuora®, Q-Bright®, AQ®, Q-Link®, and Q-Tag® are all registered trademarks of Quanta BioDesign, Ltd.
Copyright Quanta BioDesign, Ltd. 2023 - All Rights Reserved

We use cookies on our website to give you the most relevant experience by remembering your preferences and repeat visits. By clicking “Accept”, you consent to the use of ALL the cookies.

Do not sell my personal information.

Cookie settings ACCEPT

Privacy & Cookies Policy

Privacy Overview

This website uses cookies to improve your experience while you navigate through the website. Out of these cookies, the cookies that are categorized as necessary are stored on your browser as they are essential for the working of basic functionalities of the website. We also use third-party cookies that help us analyze and understand how you use this website. These cookies will be stored in your browser only with your consent. You also have the option to opt-out of these cookies. But opting out of some of these cookies may have an effect on your browsing experience.

Necessary

Always Enabled

Necessary cookies are absolutely essential for the website to function properly. This category only includes cookies that ensures basic functionalities and security features of the website. These cookies do not store any personal information.

Non-necessary

Any cookies that may not be particularly necessary for the website to function and is used specifically to collect user personal data via analytics, ads, other embedded contents are termed as non-necessary cookies. It is mandatory to procure user consent prior to running these cookies on your website.

SAVE & ACCEPT